PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN01809.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 325aa    MW: 36281.1 Da    PI: 7.3418
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN01809.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding59.19.7e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg WT+eEd +l  +v q+G+++W++I++  g+ R++k+c++rw +yl
       KHN01809.1 14 RGQWTPEEDNKLSSYVVQHGTRNWRLIPKNAGLQRCGKSCRLRWTNYL 61
                     89********************************************97 PP

2Myb_DNA-binding47.73.6e-1568110246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g ++  E++ +v+++  +G++ W++Ia+ ++ gRt++++k++w++
       KHN01809.1  68 GQFSDSEEQTIVKLHSVFGNR-WSLIAAQLP-GRTDNDVKNHWNT 110
                      789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.607.5E-25564IPR009057Homeodomain-like
PROSITE profilePS5129426.452965IPR017930Myb domain
SuperFamilySSF466893.37E-2911108IPR009057Homeodomain-like
SMARTSM007171.8E-131363IPR001005SANT/Myb domain
PfamPF002495.3E-171461IPR001005SANT/Myb domain
CDDcd001676.15E-121761No hitNo description
Gene3DG3DSA:1.10.10.601.9E-2465116IPR009057Homeodomain-like
SMARTSM007175.8E-1466114IPR001005SANT/Myb domain
PROSITE profilePS5129420.79966116IPR017930Myb domain
PfamPF002491.8E-1368110IPR001005SANT/Myb domain
CDDcd001678.20E-1170112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010090Biological Processtrichome morphogenesis
GO:0048658Biological Processanther wall tapetum development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MGRIPCCEKD NVKRGQWTPE EDNKLSSYVV QHGTRNWRLI PKNAGLQRCG KSCRLRWTNY  60
LRPDLKHGQF SDSEEQTIVK LHSVFGNRWS LIAAQLPGRT DNDVKNHWNT KLKKKLSGMG  120
IDPVTHKPFS HLMAEIATTL APPQAAHLAE AALGCFKDEV LHLLTKKPIN FHQGQHSTAA  180
LGNNFTDYVN CKPDEKDATV EKIKFDLSKA IQHDPEIMPA NKPWDSNATT SANFAMPYGV  240
FPTMSGFQLS PVSFSKGHAS QWSQSVCTGS TCTAMDQQIQ LHEKLEAEIG DDSEATKEIR  300
NLSNIFSSDC VVWDLPADDL INPVV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-28141167108B-MYB
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00564DAPTransfer from AT5G56110Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150380.0AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003530827.10.0PREDICTED: transcription factor MYB21-like
SwissprotQ7XQN11e-122MYB80_ORYSJ; Transcription factor MYB80
TrEMBLA0A0B2P2U40.0A0A0B2P2U4_GLYSO; Transcription factor MYB39
STRINGGLYMA18G07960.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF108783039
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56110.11e-110myb domain protein 103
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]